PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009773664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 922aa    MW: 103125 Da    PI: 6.0452
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009773664.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.31.8e-29613664152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l+ l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_009773664.1 613 AEKNITLQILQQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 664
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.733603684IPR003035RWP-RK domain
PfamPF020421.3E-25616664IPR003035RWP-RK domain
SuperFamilySSF542771.32E-21816904No hitNo description
Gene3DG3DSA:3.10.20.2403.4E-20822903No hitNo description
PROSITE profilePS5174522.054824907IPR000270PB1 domain
SMARTSM006663.0E-20824907IPR000270PB1 domain
PfamPF005642.2E-16826903IPR000270PB1 domain
CDDcd064072.17E-36826903No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 922 aa     Download sequence    Send to blast
MSMDERFVVT NTFLTTQFDA FMDLDYMDEL LLEGCFLETI DDRDFVHHRP SISNMPFDSS  60
FVWPTLLDTN GFEFSGSPSK DGQQERQRSS FSKNLSISQF QELNSAKVQS FGDNSINAMC  120
SSGQSENCLF DAPELSRRWW IGPNASSSVM DRLIQALGYI KNFSKDKDIL IQIWVPIYRD  180
GKRVLSTNDQ PFSLDLNCPR LAHYRQASLS YQFPANDDSK EIVGLPGRVF LDKVPEWSPD  240
VQFFQMEEYP RVGHAQQHNV RGTFAVPVFE QGSHNCLSVI EVVMTTQKIK YGSELESVCK  300
ALEAVDLRSS EVSSTLSAKA CDLTYQAALS EILEVLKSAC KTHGLPLAQT WVPCIQHGKG  360
GSRHSNENLV RCVSTEDSAC YVADPRVQGF HEACSEHHLL KGQGVVGSAF MTNQPCFTSD  420
LTSYSKAEYP LSHYARMFGL HAAVAIPLRS MSTGSSDFVL EFLLPPNCRN PEEHKSMLTS  480
LSIIIQNVCQ TYRVVSEKEL QEETVSLGEV TSLAASEYTE EVREKERKGS IVSSQERTSW  540
TSSHIEVQQT SSVISAFQDE KPVEVLTEEP VTFRNQTNSG SATTFAFSRN YRTSGEGISH  600
TWRKARDRRR LKAEKNITLQ ILQQYFAGSL KDAAKSIGVC PTTLKRICRQ HGIQRWPSRK  660
IKKVGLSLER IQRVINSVQG VSGTLQIESF YSDFPELASS NISRSSPFAD PTSNNHPEDL  720
NRQPESGGND AAISKSVSSS CSQGSSSSQR STGTQLAGHE DPVAEEASDN HALKRVNSDA  780
ELHLSSEALN PLPRSQSHTS LTESPESVSL SPVKKSLWRS QEGAPRIKVI HGEEKIRFRM  840
QKNWGYKELM REIARRFGVD DPIGFHLKYL DDDSDWVLLA CEADLEECIH VCWSSQNQTI  900
RLLFLCDLQP HLGSSFDSSS SL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773664.10.0PREDICTED: protein NLP5-like
RefseqXP_009773735.10.0PREDICTED: protein NLP5-like
RefseqXP_009773797.10.0PREDICTED: protein NLP5-like
TrEMBLM1ALT30.0M1ALT3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000256570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein